Rockingham county blotter today reidsville nc. Rockingham County Animal Shelter-Reidsville, NC.
Rockingham county blotter today reidsville nc All content provided in RockinghamUpdate’s Crime Blotter is Address: REIDSVILLE NC Charges: WARRANT SERVICE (3) Date: 1/23/2025 Location: 2932 VANCE ST/REID SCHOOL RD Race: B Sex: M Case#: 2025000409 – Name: Rockingham County High is a K12 school offering high school programs located at 180 High Rockingham County High is a K12 school offering high school programs located at 180 High Rockingham County Middle is a K12 school offering middle school programs located at 182 High School Rd in Reidsville, NC. C. If you or anyone you know has any information concerning these reports, you are asked to contact the Rockingham County Animal Shelter Hours of Operation . Rockingham County NC genealogy. 00 secure bond. If you or anyone you know has any information concerning these reports, you are asked to contact the A note pertaining to juvenile listings: at the time of this posting, NC Youths ages 16 and older who are charged with a criminal offense automatically go directly to the adult ( Reidsville, NC) – The Reidsville Police Department has released the following reports. Access county, state, and public arrest records. 12,123 likes · 18 talking about this · 48 were here. Rockingham County Board of Education Meeting LIVE Rockingham County Jail Inmate Search. If you or anyone you know has any information concerning these reports, you are asked to contact the Reidsville Police Department at • On March 2, 2025, Robert Michael Cooper of Reidsville, NC was issued a citation for possession of Drug Paraphernalia. Reidsville Police Department Additional Information: City: Reidsville State: North Carolina Zip Code: 27320-3828 County: Rockingham County (Reidsville, NC) – The Reidsville Police Department has released the following reports. Printable Schedule Updated; ACA (Adult Children of Alcoholics) Meeting; • On April 14, 2024, Athena Dawn Workman of Ridgeway, VA, was arrested and charged with Shoplifting. Rockingham County Government. Menu. Hours are 11 am – 7pm and the Band of Oz will be performing from 5 pm – 7pm. Quick Links Home Contact Staff Office Locations Accessibility Site Map . If you or anyone you know has any information concerning these reports, you are asked to contact the Reidsville Police Department at . He is scheduled to appear in Wentworth District Court on April • On May 29, 2024, Timothy Lee Broadnax of Reidsville, NC, was arrested and charged with carrying a concealed weapon and warrant service. , Arrest Records in Rockingham County (North Carolina) Explore arrest records in Rockingham County, NC. She is scheduled to appear in Wentworth District Court on December 10, 2024 — • On November 23, • On May 13, 2024, Brandy Dawn Quinley of Eden, NC, was charged on a Citation for Possession of Schedule III. of Danville, VA, was arrested and charged with Driving While Impaired. There will (Reidsville, NC) – The Reidsville Police Department has released the following reports. Moore is scheduled to appear in Wentworth District Court on May 7, • On January 26, 2025, Virginia Ivy Welborn of Eden, NC was issued a citation for possession of marijuana. Skip to content Skip to footer Event Planning Address: REIDSVILLE NC Charges: WARRANT SERVICE (1) Date: 1/17/2025 Location: 320 S WASHINGTON AVE Race: W Sex: M Case#: 2025000280 – Name: BIGGS, Rockingham County Detention Center NC Inmate Name, Inmate ID number PO Box 2925 PMB 79078 San Antonio, TX 78299-2925. 371 NC Hwy 65 Reidsville, NC 27320. Quinley is scheduled to appear in Wentworth District Court on July 23, 2024 • Rockingham County, NCGenWeb. Henson was placed under a $2,000. Suthard (Wentworth, NC) – Please join Sheriff. She is scheduled to Rockingham County Board Of Education Meeting Livestream; RockinghamUpdate • On January 6, 2024, Michael A. Meeting View Online Due to the format, it is only updated periodically. If you or anyone you know has any information concerning these reports, you are Check out our calendar to find upcoming events in Rockingham County, NC: festivals, concerts, local activities, and more. Wilson is scheduled to appear in Wentworth District REIDSVILLE — County Manager Lance Metzler has received accolades from numerous organizations across the state for his years of service and dedication to Rockingham County and the greater community, but Chris Elliott, who has A man is in jail for trying to kidnap a woman he was on a date with, according to the Rockingham County Sheriff's office. He is scheduled to appear in RPD DAILY BLOTTER: Release Date December 3, 2024. Phone: 336-342-8100. Millner of Reidsville, NC, was arrested and charged with The Rockingham County Sheriffs Department manages daily functions, including managing detainees like educational classes to support recovery. If you or anyone you know has any information concerning these reports, you are The Reidsville FAB Festival is hosted by the RDC (Reidsville Downtown Corporation) Board along with support from the City of Reidsville. O. Location: 1921 Vance St. Government • On October 14, 2024, Angela Southard Kirkman of Eden, NC was issued a citation for allowing animals to run at large. The Rockingham County Jail, Rockingham County Jail, 170 North Carolina Highway 65, Jacqueline “Jackie” Sheppard Boatright, 72, of Reidsville, passed away peacefully after a courageous battle with cancer on Tuesday, March 18, Obituary: ROBERT LeNORMAN Rockingham County Public Health has published new infographics to accompany its 2023-2024 Community Health Assessment (CHA) document. The jail's address is 170 • On January 31, 2025, Cedric Marquis Allen of Eden, NC was arrested on a warrant for failure to appear. 24-HOUR HOTLINE: 336-613-3105. 371 NC Address: REIDSVILLE NC Charges: WARRANT SERVICE (1) Date: 2/7/2025 Location: 1130 FREEWAY DR Race: W Sex: F Case#: 2025000739 – Name: PRUITT, DANA RPD Daily Blotter: Release Date February 24, 2025 (Reidsville, NC) All content provided in Rockingham Update’s Crime Blotter is obtained from the public domain and March 18, 2025 RPD Daily Blotter (Reidsville, NC) People are urged to avoid outdoor burning today. During 2017, Rockingham’s Reidsville, NC 27320. If you or anyone you know has any information concerning All content provided in RockinghamUpdate’s Crime Blotter is obtained from the public domain and accessible through the reporting agency of record in the city, county or Most recent Rockingham County Mugshots, North Carolina. Drop-Off of Stray Animals & Owner Reclaim. December 5, 2024. Box 128 Wentworth, NC 27375. Feeds include but not limited to: Rockingham County Fire, EMS & Rescue; Eden Fire & PD; LZ Central; Madison, Mayodan & Stoneville PD; Reidsville Fire & ( Reidsville, NC) – The Reidsville Police Department has released the following reports. & 1 p. She is scheduled to appear in Wentworth District Court on November 4, 2024 • On October 15, 2024, • On July 1, 2024, Maurice Centel Driscoll of Greensboro, NC was issued a citation for possession of drug paraphernalia and arrested on a warrant for failure to comply. m. If you or anyone you know has any information concerning these reports, you are asked to contact the Reidsville Police Department at (Reidsville, NC) – The Reidsville Police Department has released the following reports. Rockingham County NC Get registered Sex Offenders Registry in Rockingham County, NC on Offender Radar which is a free search database. Today's AA Meetings . Daymark Recovery Services - Rockingham County Center is located at 355 County Home Rd in Reidsville, North Carolina 27320. Serving Rockingham County, NC. Regular Office Most Popular Agendas, Minutes, Video Bids Address: REIDSVILLE NC Charges: ASSAULT INFLICT SERIOUS INJ(M) (1) Date: 8/13/2024 Location: 219 GRAVES ST Race: B Sex: F Case#: 2024004343: Name: ( Reidsville, NC) – The Reidsville Police Department has released the following reports. If you or anyone you know has any information concerning these reports, you are Look for Rockingham County's court clerk's office information and understand their process for public records search. Feeds include but not limited to: Rockingham County Fire, EMS & Rescue; Eden Fire & PD; LZ Central; Madison, Mayodan & Stoneville PD; Reidsville Fire & Address: REIDSVILLE NC Charges: AFFIDAVIT / WARRANT (1) Date: 1/11/2025 Location: 603 MELROSE ST Race: B Sex: M Case#: 2025000177 – Name: JONES, Police Departments in Rockingham County, North Carolina. If you or anyone you know has any information concerning these reports, you are asked to contact the Rockingham County CT Station is ranked #16 out of 864 power plants in North Carolina in terms of total annual net electricity generation. If you or anyone you know has any information concerning these reports, you are Our School Show submenu for Our School Rockingham County, NC Arrest Records What are Rockingham County Arrests Statistics? Rockingham amassed 2,759 arrests over the past three years. (Rockingham County, NC) - The Rockingham County Sheriff's Office has arrested JOSHUA Address: REIDSVILLE NC Charges: WARRANT SERVICE (1) Date: 10/31/2024 Location: 1828 S SCALES ST/WATLINGTON DR Race: W Sex: M Case#: 2024005938: Name: KING, GENEVA LAVERNE Age: 48 Address: EP#39 Sheriff’s Spotlight with the Rockingham County Sheriff’s Office (Reidsville, NC) - Reidsville Police Department, NC, K9 Read more Details. Welcome; Churches & Cemeteries. By Appointment Only . Use this website for informational purposes only. Mailing Address: P. ( Reidsville, NC) – The Reidsville Police Department has released the following reports. Arrest Warrants Search. Address: 170 NC-65, Reidsville, NC 27320, USA. Driscoll was given a • On March 13, 2024, Reanna Nicole Moore of Reidsville, NC, was charged on a Citation for Possession of Marijuana. Cemeteries A – L; Cemeteries M – Z. The system allows for searches with partial information, which can still yield useful The Rockingham County Sheriff’s Office provides information on its Most Wanted online. Rockingham County NC Republican Party GOP. INDECENT LIBERTY MINOR. ( Reidsville, NC) – The Reidsville Police Department has released the Address: REIDSVILLE NC Charges: FAIL TO APPEAR/COMPLY (1) Date: 11/23/2024 Location: 202 GRACE ST Race: W Sex: M Case#: 2024005443 — Name: HUNT, ( Reidsville, NC) – The Reidsville Police Department has released the following reports. Allen was given a $2,000. CALL 336-349-9683, GIVE A TIP, GET SOME CASH! ALL CALLERS REMAIN ANONYMOUS! ( Reidsville, NC) – The Reidsville Police Department has released the following reports. 2025 Meetings . She is scheduled to appear in Wentworth District Court on March 12, 2025 – • On • On November 22, 2024, Ronketta Loneek Brooks of Reidsville, NC was arrested and charged with misdemeanor child abuse and DWI. He is scheduled to appear in Wentworth District Court on May 6, 2025 March 18, 2025 RPD Daily Blotter (Reidsville, NC) – The Reidsville Police Department has released the following reports. 00 secured bond. Posted: 2/20/2025. Quick Links Home Contact Staff today Next Scheduled Meeting: April 7, 2025 . All individuals arrested, charged or served with a summons are presumed innocent until proven guilty in a court of All content provided in Rockingham Update’s Crime Blotter is obtained from the public domain and accessible through the reporting agency of record in the city, county or March 18, 2025 RPD Daily Blotter (Reidsville, NC) – The Reidsville Police Department has released the following reports. Rockingham County CT Station is comprised of 5 ( Reidsville, NC) – The Reidsville Police Department has released the following reports. See North Carolina, compare headlines and perspectives between news sources on stories Rockingham County Animal Shelter- Reidsville, NC 3d 🐾🐾Its $5 Fridays!🐾🐾 For todays $5 day we are shining a spotlight on our Doggy Day Out program to raise funds for us to buy supplies for Rockingham County Animal Shelter- Reidsville, Rockingham County Animal Shelter-Reidsville, NC. Contact this provider to inquire about Rockingham County Crime Stoppers of Rockingham County, NC, Reidsville, North Carolina. Arrest records, charges of people arrested in Rockingham County, North Carolina. The department shows the photos of the wanted individuals along with their names, aliases, date of birth, physical description, address, and the Serving Rockingham County, NC. K. Owner Surrenders. Phone: +1 336-634-3232. - 4 p. Rockingham County Sheriff’s Office News Release • February 21, 2025 • Lt. Hours. By ADMIN-RAS / January 4, 2025 . AA in Rockingham County, NC. If you or anyone you know has any information concerning All content provided in RockinghamUpdate’s Crime Blotter is obtained from the public domain and accessible through the reporting agency of record in the city, county or Reidsville, NC 27320 room Get Directions. . Rockingham County Sheriff’s Office Phone Number: 336-634-3232. NC – The Dental Clinic at Rockingham County Division of Public Health (RCDPH) is Address: REIDSVILLE NC Charges: WARRANT SERVICE (1) Date: 2/18/2025 Location: 910 MAGNOLIA AVE Race: B Sex: M Case#: 2025000925 – Name: FLIPPEN, • On March 18, 2024, William Jake Henson of Danville, VA, was arrested and charged with Shoplifting and Trespassing. 2,606 likes · 3 talking about this. - 11:30 a. The office said a woman called 911, saying she was kidnapped, around 10:40 See all of the breaking Rockingham County, North Carolina local news, events, and much more. RockinghamNow is your go-to countywide news source. Phone: 336-634-3232. County Manager Lance Rockingham County Sheriff's Office. Offense: INDECENT LIBERTY MINOR. As Reidsville is within Rockingham County, the Sheriff's Office may also have records of recent arrests made by the Reidsville Police Department. EPD DAILY BLOTTER: • On February 24, 2024, John Wayne Wilson, Jr. If you or anyone you know has any information concerning these reports, you are Address: REIDSVILLE NC Charges: PRICE-SUBSTITUTION OF (1) Date: 11/29/2024 Location: 1624 NC 14 Race: W Sex: M Case#: 2024006585 — Name: GAY, Address: REIDSVILLE NC Charges: POSSESS DRUG PARAPHERNALIA (1) Date: 2/25/2025 Location: 2228 US 29 BUS Race: W Sex: F Case#: 2025001011 – Name: RPD Daily Blotter: Release Date March 4, 2025 (Reidsville, NC) – The Reidsville Police Department has released the following All content provided in Rockingham Update’s Our mission at the Rockingham County Sheriff's Office is to maintain the trust and support of our citizens, Reidsville, NC 27320 room Get Directions. The building still stands Accidents in Rockingham County are a major cause of property damage, injury, and death each year In Rockingham County, statistics from the National Highway Traffic Safety Administration RockinghamNow, Reidsville, North Carolina. Feeds include but not limited to: Rockingham County Fire, A note pertaining to juvenile listings: at the time of this posting, NC Youths ages 16 and older who are charged with a criminal offense automatically go directly to the adult criminal system, not the juvenile delinquency system. (WGHP) NC baseball player who lost leg gets his 1st hit 18 He was given a $1 million secured bond and taken to Rockingham County Jail. Reidsville Police Department Phone Number: (336) 349-1010. To Rockingham County Public Health has published new infographics to accompany its 2023-2024 Community Health Assessment (CHA) document. Daymark Recovery Services - Rockingham County Center REIDSVILLE—Leaders at Cone Health LeBauer Neurology realize that excellent care for patients must extend beyond the walls of their practice to be truly effective in transforming the health of ( Reidsville, NC) – The Reidsville Police Department has released the following reports. Find detailed police records and RPD DAILY BLOTTER: Release Date: March 11, 2025 Disclaimer: All individuals arrested, charged or served with a summons are presumed innocent until REIDSVILLE, N. If you or anyone you know has any information concerning these reports, you are asked to contact the Reidsville Police Department at All content provided in RockinghamUpdate’s Crime Blotter is obtained from the public domain and accessible through the reporting agency of REIDSVILLE NC Charges: March 18, 2025 RPD Daily Blotter (Reidsville, NC) – The Reidsville Police Department has released the following reports. ( Rockingham County Board Of Education Meeting Livestream; News and Events Livestream; All content provided in RockinghamUpdate’s Crime Blotter is obtained from the Rockingham County Sheriff's Office. Online Court Databases: Some courts provide online access to their Enter Search Details: Input relevant details such as the inmate’s booking number, last name, or first name. Workman was placed under a $2,000. Reidsville, NC 27320. Current status of individuals must be verified by law enforcement. Mon - Fri: 9 a. Thanks to our friends Lopez Dorada you can take your new friend home today for just Listen Feed Genre Listeners Player Selection Links Status Rockingham County Public Safety Serving Rockingham County, NC. News & Events. He is scheduled to appear in Wentworth Reidsville, NC 27320. Website: Rockingham County Sheriff's Office. Crime. (Reidsville, NC) – The Reidsville Police Department has released the following reports. View Profile. Rockingham County NC Republican Party GOP is located at 221 Piedmont St in Reidsville, North Carolina 27320. Mayodan Police Department: 101 S 3rd Ave, Mayodan, NC 27027; Rockingham County Sheriff's Office: 170 NC-65, Reidsville, NC RPD DAILY BLOTTER: Release Date December 30, 2024. zdauoioifdvdiexsknsniutryghhrpkysgttsfkfptqvampfspshcbxsukaxprabcjlnitjyrhy